PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00008.1_g00055.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 478aa    MW: 55083.3 Da    PI: 5.4365
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00008.1_g00055.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.11e-5461331128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtdeel+++yLk+k++g ++el evi+evd+yk+ePwdLp k  + ++++ewyfFs+rd+ky++g+r+nratk gyWk
  Rsa1.0_00008.1_g00055.1   6 LPPGFRFHPTDEELITYYLKRKINGLEIEL-EVIAEVDLYKCEPWDLPgKaLLPSKDQEWYFFSPRDRKYPNGSRTNRATKGGYWK 90 
                              79****************************.99***************6335667999**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++v   +++++g+kktLv+y+grap+g +t Wvmheyrl
  Rsa1.0_00008.1_g00055.1  91 ATGKDRRVSW-RDRAIGTKKTLVYYRGRAPHGIRTGWVMHEYRL 133
                              *********9.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.11E-624157IPR003441NAC domain
PROSITE profilePS5100560.9356157IPR003441NAC domain
PfamPF023657.0E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0090602Biological Processsieve element enucleation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI TYYLKRKING LEIELEVIAE VDLYKCEPWD LPGKALLPSK  60
DQEWYFFSPR DRKYPNGSRT NRATKGGYWK ATGKDRRVSW RDRAIGTKKT LVYYRGRAPH  120
GIRTGWVMHE YRLDETQCEP SAYGMQDAYA LCRVFKKIVI EAKPRDQHRS YVHGMSNVSG  180
NSSFDACSDL EISSTTHQVQ NAFQPRFGNR HFNSNAMTSN EDWSQYYGSS YAPFPTPFKV  240
NNEIECSMLQ HNMSLPPLRV ENSAVSNCDF FTSMTHNNNH GVLEDFSFAA SGSNHYNSVG  300
DQVIHIGNYD EPPLMMSNHN MNQGYMEEQK IISSLDNNDQ DLGFQGDNTN DNINIDDFFS  360
FDVYNEDNVN QVEGKEDLIT NETLDSSGFE VVEEEIRFNN QMLISTYQTT KILYHQVVPS  420
HTLKVHINPI NHNVEERTLF IEEDNDSWLQ RAEKITKTKL TLVGVMAQQC YKYLAVFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A8e-56115715168NAC domain-containing protein 19
3swm_B8e-56115715168NAC domain-containing protein 19
3swm_C8e-56115715168NAC domain-containing protein 19
3swm_D8e-56115715168NAC domain-containing protein 19
3swp_A8e-56115715168NAC domain-containing protein 19
3swp_B8e-56115715168NAC domain-containing protein 19
3swp_C8e-56115715168NAC domain-containing protein 19
3swp_D8e-56115715168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00329DAPTransfer from AT3G03200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009119137.10.0PREDICTED: protein BEARSKIN1-like
SwissprotA4VCM00.0NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A078IJ230.0A0A078IJ23_BRANA; BnaCnng18420D protein
STRINGBra021366.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44111852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03200.10.0NAC domain containing protein 45